PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV29642.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family HRT-like
Protein Properties Length: 417aa    MW: 46297.8 Da    PI: 10.2154
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV29642.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like54.32.2e-17260290131
    HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                 +CGv+ ++Gs+C++++vkgRKRC eHKGm++
  KZV29642.1 260 VCGVAVGNGSICTKPAVKGRKRCSEHKGMKV 290
                 7****************************97 PP

2HRT-like51.51.7e-16324354131
    HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                 +CGvil+dGs+Ck++P+ g+KRC  HKG+R+
  KZV29642.1 324 TCGVILDDGSPCKMPPAGGNKRCMVHKGRRV 354
                 7*****************************7 PP

3HRT-like54.81.6e-17376405130
    HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                 +CG+++edG +C+rqPv gRKRC  HKGmR
  KZV29642.1 376 MCGINIEDGKICTRQPVSGRKRCNLHKGMR 405
                 6****************************9 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MGAPTAATST SAAGRRQKRE EVSYIEHDSA FSQWKILIGA ADWEDHSLGK GAERYRTHNL  60
PNCTSCPGVY ELGVGISSPL LGRDKRRLDS RAVVPVYLGQ ADNVRNRLQQ YGREGAHLAN  120
PCSNGPGLFT EIFSKGVPIV YRWAPMKNKK DAEKTEALLL QKFDYAWNKG SNGARRPDDI  180
LRKIDLYSRE SLFSLLSKKL RLFNRKRVDV EIKTCEPFFL EKRDNDQCTD VDKTGTFSRI  240
FKIRNSQPIL LSSPYSSSNV CGVAVGNGSI CTKPAVKGRK RCSEHKGMKV NGFIAKLNID  300
RKDSSDGFQN RGFEVHINNH FAPTCGVILD DGSPCKMPPA GGNKRCMVHK GRRVSGATPK  360
FVEEVEQNSL CTGRDMCGIN IEDGKICTRQ PVSGRKRCNL HKGMRQSTRS PVGRKAG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093698.11e-136PREDICTED: uncharacterized protein LOC105173599
TrEMBLA0A068U3Z61e-125A0A068U3Z6_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000838171e-124(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA77412330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.13e-78effector of transcription2